Lineage for d1sdoa_ (1sdo A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371960Family c.52.1.21: Restriction endonuclease BstyI [102471] (1 protein)
    automatically mapped to Pfam PF09195
  6. 1371961Protein Restriction endonuclease BstyI [102472] (1 species)
    local sequence similarity to BglII
  7. 1371962Species Geobacillus stearothermophilus [TaxId:1422] [102473] (3 PDB entries)
  8. 1371963Domain d1sdoa_: 1sdo A: [98809]

Details for d1sdoa_

PDB Entry: 1sdo (more details), 1.85 Å

PDB Description: Crystal Structure of Restriction Endonuclease BstYI
PDB Compounds: (A:) BstYI

SCOPe Domain Sequences for d1sdoa_:

Sequence, based on SEQRES records: (download)

>d1sdoa_ c.52.1.21 (A:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval
neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf
vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege
lynvirqgrgvpavplvligiap

Sequence, based on observed residues (ATOM records): (download)

>d1sdoa_ c.52.1.21 (A:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtilyspvalneafkekleak
gwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdfvkdrvaievqf
gkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyegelynvirqgrgv
pavplvligiap

SCOPe Domain Coordinates for d1sdoa_:

Click to download the PDB-style file with coordinates for d1sdoa_.
(The format of our PDB-style files is described here.)

Timeline for d1sdoa_: