Lineage for d1sdja2 (1sdj A:130-299)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409870Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 409871Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (2 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 409879Family d.21.1.2: PhzC/PhzF-like [89863] (2 proteins)
  6. 409884Protein Hypothetical protein YddE [89864] (1 species)
  7. 409885Species Escherichia coli [TaxId:562] [89865] (1 PDB entry)
    structural genomics; NESG target ET25
  8. 409887Domain d1sdja2: 1sdj A:130-299 [98808]
    structural genomics; NESG target ET25
    complexed with so4

Details for d1sdja2

PDB Entry: 1sdj (more details), 2.3 Å

PDB Description: x-ray structure of ydde_ecoli northeast structural genomics consortium target et25.

SCOP Domain Sequences for d1sdja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdja2 d.21.1.2 (A:130-299) Hypothetical protein YddE {Escherichia coli}
egetraaiinalhlteddilpglpiqvattghskvmiplkpevdidalspdlnaltaisk
kigcngffpfqirpgknetdgrmfspaigivedpvtgnangpmgawlvhhnvlphdgnvl
rvkghqgralgrdgmievtvtirdnqpekvtisgtavilfhaewaielgs

SCOP Domain Coordinates for d1sdja2:

Click to download the PDB-style file with coordinates for d1sdja2.
(The format of our PDB-style files is described here.)

Timeline for d1sdja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sdja1