Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.39: Penicillinase repressor [101016] (4 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain automatically mapped to Pfam PF03965 |
Protein Methicillin resistance regulatory protein MecI [101017] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries) |
Domain d1sd6b_: 1sd6 B: [98804] |
PDB Entry: 1sd6 (more details), 2.65 Å
SCOPe Domain Sequences for d1sd6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sd6b_ a.4.5.39 (B:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn kifqyyslveesdikyktsknfinkvykggfnslvlnfvekeelsqdeieelrnilnk
Timeline for d1sd6b_: