Lineage for d1sc5a3 (1sc5 A:2-86)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752715Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 1752716Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 1752717Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 1752722Protein Sigma factor sigma-28 (FliA) [101383] (1 species)
  7. 1752723Species Aquifex aeolicus [TaxId:63363] [101384] (2 PDB entries)
  8. 1752728Domain d1sc5a3: 1sc5 A:2-86 [98800]
    Other proteins in same PDB: d1sc5a1, d1sc5a2, d1sc5b_
    protein/RNA complex

Details for d1sc5a3

PDB Entry: 1sc5 (more details), 3.26 Å

PDB Description: Sigma-28(FliA)/FlgM complex
PDB Compounds: (A:) RNA polymerase sigma factor FliA

SCOPe Domain Sequences for d1sc5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc5a3 a.177.1.1 (A:2-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}
knpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlsten
pkraeayiklrikgaiydylrsldf

SCOPe Domain Coordinates for d1sc5a3:

Click to download the PDB-style file with coordinates for d1sc5a3.
(The format of our PDB-style files is described here.)

Timeline for d1sc5a3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sc5b_