Lineage for d1sc5a3 (1sc5 A:2-86)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362332Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 362333Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 362334Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 362339Protein Sigma factor sigma-28 (FliA) [101383] (1 species)
  7. 362340Species Aquifex aeolicus [TaxId:63363] [101384] (2 PDB entries)
  8. 362345Domain d1sc5a3: 1sc5 A:2-86 [98800]
    Other proteins in same PDB: d1sc5a1, d1sc5a2, d1sc5b_

Details for d1sc5a3

PDB Entry: 1sc5 (more details), 3.26 Å

PDB Description: Sigma-28(FliA)/FlgM complex
PDB Compounds: (A:)

SCOP Domain Sequences for d1sc5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc5a3 a.177.1.1 (A:2-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus}
knpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlsten
pkraeayiklrikgaiydylrsldf

SCOP Domain Coordinates for d1sc5a3:

Click to download the PDB-style file with coordinates for d1sc5a3.
(The format of our PDB-style files is described here.)

Timeline for d1sc5a3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sc5b_