SCOP 1.73: Domain d1sc0b_: 1sc0 B:

Lineage for d1sc0b_ (1sc0 B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)

6. Protein Hypothetical protein HI1161 [89905] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89906] (3 PDB entries)

8. Domain d1sc0b_: 1sc0 B: [98797]
   structural genomics; NESG target IR63

Details for d1sc0b_

PDB Entry: 1sc0, 1.7 Å

PDB Description: X-ray Structure of YB61_HAEIN Northeast Structural Genomics Consortium Target IR63

PDB Compounds: (B:) Hypothetical protein HI1161

SCOP Domain Sequences for d1sc0b_:

Sequence; same for both SEQRES and ATOM records:

>d1sc0b_ d.38.1.5 (B:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
enklccvsrltlsvinl

Timeline for d1sc0b_:

• d1sc0b_ first appeared in SCOP 1.67
  
• d1sc0b_ appears in SCOP 1.71
  
• d1sc0b_ appears in SCOP 1.75
  
• d1sc0b_ appears in the current release, SCOPe 2.08