SCOP 1.71: Domain d1sbkd_: 1sbk D:

Lineage for d1sbkd_ (1sbk D:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)

6. Protein Hypothetical protein YdiI [102910] (1 species)

7. Species Escherichia coli [TaxId:562] [102911] (3 PDB entries)

8. Domain d1sbkd_: 1sbk D: [98794]
   structural genomics; NESG target ER29
   complexed with so4

Details for d1sbkd_

PDB Entry: 1sbk, 2 Å

PDB Description: x-ray structure of ydii_ecoli northeast structural genomics consortium target er29.

SCOP Domain Sequences for d1sbkd_:

Sequence; same for both SEQRES and ATOM records:

>d1sbkd_ d.38.1.5 (D:) Hypothetical protein YdiI {Escherichia coli}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttaille

Timeline for d1sbkd_:

• d1sbkd_ first appeared in SCOP 1.67
  
• d1sbkd_ appears in SCOP 1.69
  
• d1sbkd_ appears in SCOP 1.73
  
• d1sbkd_ appears in the current release, SCOPe 2.08, called d1sbkd1