Lineage for d1sbkc_ (1sbk C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502577Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502578Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 502657Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)
  6. 502683Protein Hypothetical protein YdiI [102910] (1 species)
  7. 502684Species Escherichia coli [TaxId:562] [102911] (3 PDB entries)
  8. 502689Domain d1sbkc_: 1sbk C: [98793]

Details for d1sbkc_

PDB Entry: 1sbk (more details), 2 Å

PDB Description: x-ray structure of ydii_ecoli northeast structural genomics consortium target er29.

SCOP Domain Sequences for d1sbkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbkc_ d.38.1.5 (C:) Hypothetical protein YdiI {Escherichia coli}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttaille

SCOP Domain Coordinates for d1sbkc_:

Click to download the PDB-style file with coordinates for d1sbkc_.
(The format of our PDB-style files is described here.)

Timeline for d1sbkc_: