SCOP 1.73: Domain d1sbkb_: 1sbk B:

Lineage for d1sbkb_ (1sbk B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)

6. Protein Hypothetical protein YdiI [102910] (1 species)

7. Species Escherichia coli [TaxId:562] [102911] (3 PDB entries)

8. Domain d1sbkb_: 1sbk B: [98792]

Details for d1sbkb_

PDB Entry: 1sbk, 2 Å

PDB Description: x-ray structure of ydii_ecoli northeast structural genomics consortium target er29.

PDB Compounds: (B:) Hypothetical protein ydiI

SCOP Domain Sequences for d1sbkb_:

Sequence; same for both SEQRES and ATOM records:

>d1sbkb_ d.38.1.5 (B:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttaille

Timeline for d1sbkb_:

• d1sbkb_ first appeared in SCOP 1.67
  
• d1sbkb_ appears in SCOP 1.71
  
• d1sbkb_ appears in SCOP 1.75
  
• d1sbkb_ appears in the current release, SCOPe 2.08, called d1sbkb1