Lineage for d1sbka_ (1sbk A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902040Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1902094Protein Hypothetical protein YdiI [102910] (1 species)
  7. 1902095Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)
  8. 1902102Domain d1sbka_: 1sbk A: [98791]
    structural genomics; NESG target ER29
    complexed with so4

Details for d1sbka_

PDB Entry: 1sbk (more details), 2 Å

PDB Description: x-ray structure of ydii_ecoli northeast structural genomics consortium target er29.
PDB Compounds: (A:) Hypothetical protein ydiI

SCOPe Domain Sequences for d1sbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbka_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttaille

SCOPe Domain Coordinates for d1sbka_:

Click to download the PDB-style file with coordinates for d1sbka_.
(The format of our PDB-style files is described here.)

Timeline for d1sbka_: