Lineage for d1saxb_ (1sax B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694053Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
    automatically mapped to Pfam PF03965
  6. 2694058Protein Methicillin resistance regulatory protein MecI [101017] (1 species)
  7. 2694059Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries)
  8. 2694063Domain d1saxb_: 1sax B: [98788]
    complexed with DNA
    protein/DNA complex; complexed with k

Details for d1saxb_

PDB Entry: 1sax (more details), 2.8 Å

PDB Description: Three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci in complex with 25-bp ds-DNA
PDB Compounds: (B:) Methicillin resistance regulatory protein mecI

SCOPe Domain Sequences for d1saxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1saxb_ a.4.5.39 (B:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]}
nktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkk
dnkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnilnk

SCOPe Domain Coordinates for d1saxb_:

Click to download the PDB-style file with coordinates for d1saxb_.
(The format of our PDB-style files is described here.)

Timeline for d1saxb_: