SCOPe 2.08: Domain d1saxa_: 1sax A:

Lineage for d1saxa_ (1sax A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
   automatically mapped to Pfam PF03965

6. Protein Methicillin resistance regulatory protein MecI [101017] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries)

8. Domain d1saxa_: 1sax A: [98787]
   complexed with DNA
   protein/DNA complex; complexed with k

Details for d1saxa_

PDB Entry: 1sax, 2.8 Å

PDB Description: Three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci in complex with 25-bp ds-DNA

PDB Compounds: (A:) Methicillin resistance regulatory protein mecI

SCOPe Domain Sequences for d1saxa_:

Sequence; same for both SEQRES and ATOM records:

>d1saxa_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]}
nktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkk
dnkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnilnk

Timeline for d1saxa_:

• d1saxa_ first appeared in SCOP 1.67
  
• d1saxa_ appears in SCOPe 2.07