Class a: All alpha proteins [46456] (285 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (1 protein) |
Protein Stathmin 4 [101496] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (25 PDB entries) |
Domain d1sa1e_: 1sa1 E: [98786] Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b1, d1sa1b2, d1sa1c1, d1sa1c2, d1sa1d1, d1sa1d2 complexed with gdp, gtp, mg, pod |
PDB Entry: 1sa1 (more details), 4.2 Å
SCOPe Domain Sequences for d1sa1e_:
Sequence, based on SEQRES records: (download)
>d1sa1e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d1sa1e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrpsleeiqkkleaaeerrkyqeae llkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekd khaeevrknkelke
Timeline for d1sa1e_: