Lineage for d1sa1e_ (1sa1 E:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449350Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 449441Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
  5. 449442Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 449443Protein Stathmin 4 [101496] (1 species)
  7. 449444Species Rat (Rattus norvegicus) [TaxId:10116] [101497] (2 PDB entries)
  8. 449446Domain d1sa1e_: 1sa1 E: [98786]
    Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b1, d1sa1b2, d1sa1c1, d1sa1c2, d1sa1d1, d1sa1d2

Details for d1sa1e_

PDB Entry: 1sa1 (more details), 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex

SCOP Domain Sequences for d1sa1e_:

Sequence, based on SEQRES records: (download)

>d1sa1e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus)}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d1sa1e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus)}
mevielnkctsgqsfevilkppsfdgvpefnaslprrpsleeiqkkleaaeerrkyqeae
llkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekd
khaeevrknkelke

SCOP Domain Coordinates for d1sa1e_:

Click to download the PDB-style file with coordinates for d1sa1e_.
(The format of our PDB-style files is described here.)

Timeline for d1sa1e_: