SCOPe 2.04: Domain d1sa1d2: 1sa1 D:246-437

Lineage for d1sa1d2 (1sa1 D:246-437)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Tubulin beta-subunit [55313] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64322] (5 PDB entries)
   Uniprot P02554

8. Domain d1sa1d2: 1sa1 D:246-437 [98785]
   Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b1, d1sa1c1, d1sa1c2, d1sa1d1, d1sa1e_
   complexed with gdp, gtp, mg, pod

Details for d1sa1d2

PDB Entry: 1sa1, 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d1sa1d2:

Sequence; same for both SEQRES and ATOM records:

>d1sa1d2 d.79.2.1 (D:246-437) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

Timeline for d1sa1d2:

• d1sa1d2 first appeared in SCOP 1.67
  
• d1sa1d2 appears in SCOPe 2.03
  
• d1sa1d2 appears in SCOPe 2.05
  
• d1sa1d2 appears in the current release, SCOPe 2.08