Lineage for d1sa1d1 (1sa1 D:2-245)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592224Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592225Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1592226Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1592319Protein Tubulin beta-subunit [52496] (2 species)
  7. 1592320Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries)
    Uniprot P02550 ! Uniprot P02554
  8. 1592327Domain d1sa1d1: 1sa1 D:2-245 [98784]
    Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b2, d1sa1c1, d1sa1c2, d1sa1d2, d1sa1e_
    complexed with gdp, gtp, mg, pod

Details for d1sa1d1

PDB Entry: 1sa1 (more details), 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex
PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d1sa1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa1d1 c.32.1.1 (D:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d1sa1d1:

Click to download the PDB-style file with coordinates for d1sa1d1.
(The format of our PDB-style files is described here.)

Timeline for d1sa1d1: