Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Tubulin alpha-subunit [55311] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [64321] (5 PDB entries) Uniprot P02550 |
Domain d1sa1c2: 1sa1 C:246-439 [98783] Other proteins in same PDB: d1sa1a1, d1sa1b1, d1sa1b2, d1sa1c1, d1sa1d1, d1sa1d2, d1sa1e_ complexed with gdp, gtp, mg, pod |
PDB Entry: 1sa1 (more details), 4.2 Å
SCOPe Domain Sequences for d1sa1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sa1c2 d.79.2.1 (C:246-439) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvds
Timeline for d1sa1c2: