Lineage for d1sa1c2 (1sa1 C:246-439)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959167Protein Tubulin alpha-subunit [55311] (3 species)
  7. 2959168Species Cow (Bos taurus) [TaxId:9913] [64321] (5 PDB entries)
    Uniprot P02550
  8. 2959176Domain d1sa1c2: 1sa1 C:246-439 [98783]
    Other proteins in same PDB: d1sa1a1, d1sa1b1, d1sa1b2, d1sa1c1, d1sa1d1, d1sa1d2, d1sa1e_
    complexed with gdp, gtp, mg, pod

Details for d1sa1c2

PDB Entry: 1sa1 (more details), 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex
PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d1sa1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa1c2 d.79.2.1 (C:246-439) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d1sa1c2:

Click to download the PDB-style file with coordinates for d1sa1c2.
(The format of our PDB-style files is described here.)

Timeline for d1sa1c2: