Lineage for d1sa1c1 (1sa1 C:2-245)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828655Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 828656Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 828657Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 828696Protein Tubulin alpha-subunit [52494] (3 species)
  7. 828697Species Cow (Bos taurus) [TaxId:9913] [63989] (4 PDB entries)
  8. 828704Domain d1sa1c1: 1sa1 C:2-245 [98782]
    Other proteins in same PDB: d1sa1a2, d1sa1b1, d1sa1b2, d1sa1c2, d1sa1d1, d1sa1d2, d1sa1e_
    complexed with gdp, gtp, mg, pod

Details for d1sa1c1

PDB Entry: 1sa1 (more details), 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex
PDB Compounds: (C:) Tubulin alpha chain

SCOP Domain Sequences for d1sa1c1:

Sequence, based on SEQRES records: (download)

>d1sa1c1 c.32.1.1 (C:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d1sa1c1 c.32.1.1 (C:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdsfntffsetgagkhvpravfvd
leptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqc
tglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsil
tthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfd

SCOP Domain Coordinates for d1sa1c1:

Click to download the PDB-style file with coordinates for d1sa1c1.
(The format of our PDB-style files is described here.)

Timeline for d1sa1c1: