SCOPe 2.04: Domain d1sa1b1: 1sa1 B:2-245

Lineage for d1sa1b1 (1sa1 B:2-245)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Tubulin beta-subunit [52496] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries)
   Uniprot P02550 ! Uniprot P02554

8. Domain d1sa1b1: 1sa1 B:2-245 [98780]
   Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b2, d1sa1c1, d1sa1c2, d1sa1d2, d1sa1e_
   complexed with gdp, gtp, mg, pod

Details for d1sa1b1

PDB Entry: 1sa1, 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1sa1b1:

Sequence; same for both SEQRES and ATOM records:

>d1sa1b1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d1sa1b1:

• d1sa1b1 first appeared in SCOP 1.67
  
• d1sa1b1 appears in SCOPe 2.03
  
• d1sa1b1 appears in SCOPe 2.05
  
• d1sa1b1 appears in the current release, SCOPe 2.08