![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Tubulin beta-subunit [52496] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries) Uniprot P02550 ! Uniprot P02554 |
![]() | Domain d1sa1b1: 1sa1 B:2-245 [98780] Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b2, d1sa1c1, d1sa1c2, d1sa1d2, d1sa1e_ complexed with gdp, gtp, mg, pod |
PDB Entry: 1sa1 (more details), 4.2 Å
SCOPe Domain Sequences for d1sa1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sa1b1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d1sa1b1: