SCOP 1.71: Domain d1sa1b1: 1sa1 B:2-245

Lineage for d1sa1b1 (1sa1 B:2-245)

Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)
Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
Protein Tubulin beta-subunit [52496] (2 species)
Species Cow (Bos taurus) [TaxId:9913] [63990] (4 PDB entries)
Domain d1sa1b1: 1sa1 B:2-245 [98780]
Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b2, d1sa1c1, d1sa1c2, d1sa1d2, d1sa1e_

Details for d1sa1b1

PDB Entry: 1sa1 (more details), 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex

SCOP Domain Sequences for d1sa1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa1b1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus)}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOP Domain Coordinates for d1sa1b1:

Click to download the PDB-style file with coordinates for d1sa1b1.
(The format of our PDB-style files is described here.)

Timeline for d1sa1b1: