Lineage for d1sa1b1 (1sa1 B:2-245)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392946Fold c.32: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 392947Superfamily c.32.1: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52490] (2 families) (S)
  5. 392948Family c.32.1.1: Tubulin, GTPase domain [52491] (3 protein domains)
  6. 392964Protein Tubulin beta-subunit [52496] (2 species)
  7. 392965Species Cow (Bos taurus) [TaxId:9913] [63990] (3 PDB entries)
  8. 392969Domain d1sa1b1: 1sa1 B:2-245 [98780]
    Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b2, d1sa1c1, d1sa1c2, d1sa1d2, d1sa1e_

Details for d1sa1b1

PDB Entry: 1sa1 (more details), 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex

SCOP Domain Sequences for d1sa1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa1b1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus)}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOP Domain Coordinates for d1sa1b1:

Click to download the PDB-style file with coordinates for d1sa1b1.
(The format of our PDB-style files is described here.)

Timeline for d1sa1b1: