![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (1 protein) |
![]() | Protein Stathmin 4 [101496] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (21 PDB entries) |
![]() | Domain d1sa0e_: 1sa0 E: [98777] Other proteins in same PDB: d1sa0a1, d1sa0a2, d1sa0b1, d1sa0b2, d1sa0c1, d1sa0c2, d1sa0d1, d1sa0d2 complexed with cn2, gdp, gtp, mg |
PDB Entry: 1sa0 (more details), 3.58 Å
SCOPe Domain Sequences for d1sa0e_:
Sequence, based on SEQRES records: (download)
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl qekdkhaeevrknkelke
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} admevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekre hereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknk elke
Timeline for d1sa0e_: