Lineage for d1sa0e_ (1sa0 E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544787Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 544881Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
  5. 544882Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 544883Protein Stathmin 4 [101496] (1 species)
  7. 544884Species Rat (Rattus norvegicus) [TaxId:10116] [101497] (2 PDB entries)
  8. 544885Domain d1sa0e_: 1sa0 E: [98777]
    Other proteins in same PDB: d1sa0a1, d1sa0a2, d1sa0b1, d1sa0b2, d1sa0c1, d1sa0c2, d1sa0d1, d1sa0d2
    complexed with cn2, gdp, gtp, mg

Details for d1sa0e_

PDB Entry: 1sa0 (more details), 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex

SCOP Domain Sequences for d1sa0e_:

Sequence, based on SEQRES records: (download)

>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus)}
admevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus)}
admevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekre
hereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknk
elke

SCOP Domain Coordinates for d1sa0e_:

Click to download the PDB-style file with coordinates for d1sa0e_.
(The format of our PDB-style files is described here.)

Timeline for d1sa0e_: