Lineage for d1sa0d2 (1sa0 D:246-438)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865803Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 865804Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 865861Protein Tubulin beta-subunit [55313] (2 species)
  7. 865862Species Cow (Bos taurus) [TaxId:9913] [64322] (7 PDB entries)
    Uniprot P02554
  8. 865865Domain d1sa0d2: 1sa0 D:246-438 [98776]
    Other proteins in same PDB: d1sa0a1, d1sa0a2, d1sa0b1, d1sa0c1, d1sa0c2, d1sa0d1, d1sa0e_
    complexed with cn2, gdp, gtp, mg

Details for d1sa0d2

PDB Entry: 1sa0 (more details), 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex
PDB Compounds: (D:) Tubulin beta chain

SCOP Domain Sequences for d1sa0d2:

Sequence, based on SEQRES records: (download)

>d1sa0d2 d.79.2.1 (D:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d1sa0d2 d.79.2.1 (D:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdaknmmaacdprhgryl
tvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfigns
taiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOP Domain Coordinates for d1sa0d2:

Click to download the PDB-style file with coordinates for d1sa0d2.
(The format of our PDB-style files is described here.)

Timeline for d1sa0d2: