SCOPe 2.02: Domain d1sa0d1: 1sa0 D:2-245

Lineage for d1sa0d1 (1sa0 D:2-245)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)

6. Protein Tubulin beta-subunit [52496] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries)
   Uniprot P02550 ! Uniprot P02554

8. Domain d1sa0d1: 1sa0 D:2-245 [98775]
   Other proteins in same PDB: d1sa0a1, d1sa0a2, d1sa0b2, d1sa0c1, d1sa0c2, d1sa0d2, d1sa0e_
   complexed with cn2, gdp, gtp, mg

Details for d1sa0d1

PDB Entry: 1sa0, 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d1sa0d1:

Sequence; same for both SEQRES and ATOM records:

>d1sa0d1 c.32.1.1 (D:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d1sa0d1:

• d1sa0d1 first appeared in SCOP 1.67
  
• d1sa0d1 appears in SCOPe 2.01
  
• d1sa0d1 appears in SCOPe 2.03
  
• d1sa0d1 appears in the current release, SCOPe 2.08