Lineage for d1sa0c2 (1sa0 C:246-437)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032295Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 1032296Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 1032335Protein Tubulin alpha-subunit [55311] (3 species)
  7. 1032336Species Cow (Bos taurus) [TaxId:9913] [64321] (5 PDB entries)
    Uniprot P02550
  8. 1032339Domain d1sa0c2: 1sa0 C:246-437 [98774]
    Other proteins in same PDB: d1sa0a1, d1sa0b1, d1sa0b2, d1sa0c1, d1sa0d1, d1sa0d2, d1sa0e_
    complexed with cn2, gdp, gtp, mg

Details for d1sa0c2

PDB Entry: 1sa0 (more details), 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex
PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d1sa0c2:

Sequence, based on SEQRES records: (download)

>d1sa0c2 d.79.2.1 (C:246-437) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Sequence, based on observed residues (ATOM records): (download)

>d1sa0c2 d.79.2.1 (C:246-437) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaeqlsvaeitnacfepanqmvkcdprhg
kymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlak
vqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaalek
dyeevgv

SCOPe Domain Coordinates for d1sa0c2:

Click to download the PDB-style file with coordinates for d1sa0c2.
(The format of our PDB-style files is described here.)

Timeline for d1sa0c2: