SCOPe 2.02: Domain d1sa0b2: 1sa0 B:246-438

Lineage for d1sa0b2 (1sa0 B:246-438)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Tubulin beta-subunit [55313] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64322] (5 PDB entries)
   Uniprot P02554

8. Domain d1sa0b2: 1sa0 B:246-438 [98772]
   Other proteins in same PDB: d1sa0a1, d1sa0a2, d1sa0b1, d1sa0c1, d1sa0c2, d1sa0d1, d1sa0e_
   complexed with cn2, gdp, gtp, mg

Details for d1sa0b2

PDB Entry: 1sa0, 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1sa0b2:

Sequence, based on SEQRES records:

>d1sa0b2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records):

>d1sa0b2 d.79.2.1 (B:246-438) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsltvpeltqqmfdaknmmaacdprhgryl
tvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfigns
taiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

Timeline for d1sa0b2:

• d1sa0b2 first appeared in SCOP 1.67
  
• d1sa0b2 appears in SCOPe 2.01
  
• d1sa0b2 appears in SCOPe 2.03
  
• d1sa0b2 appears in the current release, SCOPe 2.08