Lineage for d1sa0a2 (1sa0 A:246-437)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420907Protein Tubulin alpha-subunit [55311] (3 species)
  7. 1420908Species Cow (Bos taurus) [TaxId:9913] [64321] (5 PDB entries)
    Uniprot P02550
  8. 1420910Domain d1sa0a2: 1sa0 A:246-437 [98770]
    Other proteins in same PDB: d1sa0a1, d1sa0b1, d1sa0b2, d1sa0c1, d1sa0d1, d1sa0d2, d1sa0e_
    complexed with cn2, gdp, gtp, mg

Details for d1sa0a2

PDB Entry: 1sa0 (more details), 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d1sa0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa0a2 d.79.2.1 (A:246-437) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d1sa0a2:

Click to download the PDB-style file with coordinates for d1sa0a2.
(The format of our PDB-style files is described here.)

Timeline for d1sa0a2: