Lineage for d1sa0a2 (1sa0 A:246-437)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414157Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 414256Superfamily d.79.2: Tubulin/Dihydroxyacetone kinase C-terminal domain [55307] (2 families) (S)
  5. 414257Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 414264Protein Tubulin alpha-subunit [55311] (2 species)
  7. 414265Species Cow (Bos taurus) [TaxId:9913] [64321] (3 PDB entries)
  8. 414267Domain d1sa0a2: 1sa0 A:246-437 [98770]
    Other proteins in same PDB: d1sa0a1, d1sa0b1, d1sa0b2, d1sa0c1, d1sa0d1, d1sa0d2, d1sa0e_

Details for d1sa0a2

PDB Entry: 1sa0 (more details), 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex

SCOP Domain Sequences for d1sa0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa0a2 d.79.2.1 (A:246-437) Tubulin alpha-subunit {Cow (Bos taurus)}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOP Domain Coordinates for d1sa0a2:

Click to download the PDB-style file with coordinates for d1sa0a2.
(The format of our PDB-style files is described here.)

Timeline for d1sa0a2: