Lineage for d1sa0a1 (1sa0 A:2-245)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828655Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 828656Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 828657Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 828696Protein Tubulin alpha-subunit [52494] (3 species)
  7. 828697Species Cow (Bos taurus) [TaxId:9913] [63989] (4 PDB entries)
  8. 828699Domain d1sa0a1: 1sa0 A:2-245 [98769]
    Other proteins in same PDB: d1sa0a2, d1sa0b1, d1sa0b2, d1sa0c2, d1sa0d1, d1sa0d2, d1sa0e_

Details for d1sa0a1

PDB Entry: 1sa0 (more details), 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex
PDB Compounds: (A:) Tubulin alpha chain

SCOP Domain Sequences for d1sa0a1:

Sequence, based on SEQRES records: (download)

>d1sa0a1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d1sa0a1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpdsfntffsetgagkhvpravfvdl
eptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqct
glqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsilt
thttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfd

SCOP Domain Coordinates for d1sa0a1:

Click to download the PDB-style file with coordinates for d1sa0a1.
(The format of our PDB-style files is described here.)

Timeline for d1sa0a1: