SCOPe 2.08: Domain d1s9ve1: 1s9v E:95-190

Lineage for d1s9ve1 (1s9v E:95-190)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88630] (3 PDB entries)
   probably orthologous to the mouse I-A group

8. Domain d1s9ve1: 1s9v E:95-190 [98766]
   Other proteins in same PDB: d1s9va1, d1s9va2, d1s9vb2, d1s9vd1, d1s9vd2, d1s9ve2
   complexed with deamidated gliadin peptide
   complexed with edo

Details for d1s9ve1

PDB Entry: 1s9v, 2.22 Å

PDB Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide

PDB Compounds: (E:) HLA class II histocompatibility antigen, DQ(1) beta chain

SCOPe Domain Sequences for d1s9ve1:

Sequence, based on SEQRES records:

>d1s9ve1 b.1.1.2 (E:95-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]}
veptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwt
fqilvmlemtpqrgdvytchvehpslqspitvewra

Sequence, based on observed residues (ATOM records):

>d1s9ve1 b.1.1.2 (E:95-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]}
veptvtispsnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvmle
mtpqrgdvytchvehpslqspitvewra

Timeline for d1s9ve1:

• d1s9ve1 first appeared in SCOP 1.67
  
• d1s9ve1 appears in SCOPe 2.07