Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DQ2 [TaxId:9606] [102833] (1 PDB entry) |
Domain d1s9vd2: 1s9v D:2-84 [98765] Other proteins in same PDB: d1s9va1, d1s9vb1, d1s9vb2, d1s9vd1, d1s9ve1, d1s9ve2 complexed with deamidated gliadin peptide |
PDB Entry: 1s9v (more details), 2.22 Å
SCOP Domain Sequences for d1s9vd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9vd2 d.19.1.1 (D:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ2} vadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfalt niavlkhnlnslikrsnstaatn
Timeline for d1s9vd2: