Lineage for d1s9vd2 (1s9v D:2-84)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501366Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 501369Species Human (Homo sapiens), HLA-DQ2 [TaxId:9606] [102833] (1 PDB entry)
  8. 501371Domain d1s9vd2: 1s9v D:2-84 [98765]
    Other proteins in same PDB: d1s9va1, d1s9vb1, d1s9vb2, d1s9vd1, d1s9ve1, d1s9ve2
    complexed with deamidated gliadin peptide

Details for d1s9vd2

PDB Entry: 1s9v (more details), 2.22 Å

PDB Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide

SCOP Domain Sequences for d1s9vd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9vd2 d.19.1.1 (D:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ2}
vadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfalt
niavlkhnlnslikrsnstaatn

SCOP Domain Coordinates for d1s9vd2:

Click to download the PDB-style file with coordinates for d1s9vd2.
(The format of our PDB-style files is described here.)

Timeline for d1s9vd2: