Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88623] (3 PDB entries) probably orthologous to the mouse I-A group |
Domain d1s9vd1: 1s9v D:85-178 [98764] Other proteins in same PDB: d1s9va2, d1s9vb1, d1s9vb2, d1s9vd2, d1s9ve1, d1s9ve2 complexed with deamidated gliadin peptide complexed with edo |
PDB Entry: 1s9v (more details), 2.22 Å
SCOP Domain Sequences for d1s9vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9vd1 b.1.1.2 (D:85-178) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group} evpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsksdhs ffkisyltllpsaeesydckvehwgldkpllkhw
Timeline for d1s9vd1: