Lineage for d1s9vb2 (1s9v B:3-94)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897932Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1897935Species Human (Homo sapiens), HLA-DQ2 [TaxId:9606] [102835] (1 PDB entry)
  8. 1897936Domain d1s9vb2: 1s9v B:3-94 [98763]
    Other proteins in same PDB: d1s9va1, d1s9va2, d1s9vb1, d1s9vd1, d1s9vd2, d1s9ve1
    complexed with deamidated gliadin peptide
    complexed with edo

Details for d1s9vb2

PDB Entry: 1s9v (more details), 2.22 Å

PDB Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide
PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ(1) beta chain

SCOPe Domain Sequences for d1s9vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9vb2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ2 [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlqrr

SCOPe Domain Coordinates for d1s9vb2:

Click to download the PDB-style file with coordinates for d1s9vb2.
(The format of our PDB-style files is described here.)

Timeline for d1s9vb2: