Lineage for d1s9vb2 (1s9v B:3-94)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501465Species Human (Homo sapiens), HLA-DQ2 [TaxId:9606] [102835] (1 PDB entry)
  8. 501466Domain d1s9vb2: 1s9v B:3-94 [98763]
    Other proteins in same PDB: d1s9va1, d1s9va2, d1s9vb1, d1s9vd1, d1s9vd2, d1s9ve1

Details for d1s9vb2

PDB Entry: 1s9v (more details), 2.22 Å

PDB Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide

SCOP Domain Sequences for d1s9vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9vb2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ2}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlqrr

SCOP Domain Coordinates for d1s9vb2:

Click to download the PDB-style file with coordinates for d1s9vb2.
(The format of our PDB-style files is described here.)

Timeline for d1s9vb2: