Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Human (Homo sapiens), HLA-DQ2 [TaxId:9606] [102835] (1 PDB entry) |
Domain d1s9vb2: 1s9v B:3-94 [98763] Other proteins in same PDB: d1s9va1, d1s9va2, d1s9vb1, d1s9vd1, d1s9vd2, d1s9ve1 complexed with deamidated gliadin peptide complexed with edo fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1s9v (more details), 2.22 Å
SCOPe Domain Sequences for d1s9vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9vb2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ2 [TaxId: 9606]} spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn sqkdilerkraavdrvcrhnyqlelrttlqrr
Timeline for d1s9vb2: