![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DQ2 [TaxId:9606] [102833] (1 PDB entry) |
![]() | Domain d1s9va2: 1s9v A:2-84 [98761] Other proteins in same PDB: d1s9va1, d1s9vb1, d1s9vb2, d1s9vd1, d1s9ve1, d1s9ve2 complexed with deamidated gliadin peptide complexed with edo fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1s9v (more details), 2.22 Å
SCOPe Domain Sequences for d1s9va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9va2 d.19.1.1 (A:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ2 [TaxId: 9606]} vadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfalt niavlkhnlnslikrsnstaatn
Timeline for d1s9va2: