Lineage for d1s9va1 (1s9v A:85-180)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364807Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 364810Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88623] (3 PDB entries)
    probably orthologous to the mouse I-A group
  8. 364812Domain d1s9va1: 1s9v A:85-180 [98760]
    Other proteins in same PDB: d1s9va2, d1s9vb1, d1s9vb2, d1s9vd2, d1s9ve1, d1s9ve2

Details for d1s9va1

PDB Entry: 1s9v (more details), 2.22 Å

PDB Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide

SCOP Domain Sequences for d1s9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9va1 b.1.1.2 (A:85-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group}
evpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsksdhs
ffkisyltllpsaeesydckvehwgldkpllkhwep

SCOP Domain Coordinates for d1s9va1:

Click to download the PDB-style file with coordinates for d1s9va1.
(The format of our PDB-style files is described here.)

Timeline for d1s9va1: