SCOPe 2.08: Domain d1s9va1: 1s9v A:85-180

Lineage for d1s9va1 (1s9v A:85-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88623] (3 PDB entries)
   probably orthologous to the mouse I-A group

8. Domain d1s9va1: 1s9v A:85-180 [98760]
   Other proteins in same PDB: d1s9va2, d1s9vb1, d1s9vb2, d1s9vd2, d1s9ve1, d1s9ve2
   complexed with deamidated gliadin peptide
   complexed with edo

Details for d1s9va1

PDB Entry: 1s9v, 2.22 Å

PDB Description: Crystal structure of HLA-DQ2 complexed with deamidated gliadin peptide

PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ(3) alpha chain

SCOPe Domain Sequences for d1s9va1:

Sequence; same for both SEQRES and ATOM records:

>d1s9va1 b.1.1.2 (A:85-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]}
evpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsksdhs
ffkisyltllpsaeesydckvehwgldkpllkhwep

Timeline for d1s9va1:

• d1s9va1 first appeared in SCOP 1.67
  
• d1s9va1 appears in SCOPe 2.07