Lineage for d1s9ra_ (1s9r A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213841Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 2213842Protein Arginine deiminase [103233] (2 species)
  7. 2213843Species Mycoplasma arginini [TaxId:2094] [103235] (2 PDB entries)
  8. 2213844Domain d1s9ra_: 1s9r A: [98758]
    complexed with arg, trs, unx

Details for d1s9ra_

PDB Entry: 1s9r (more details), 1.6 Å

PDB Description: crystal structure of arginine deiminase covalently linked with a reaction intermediate
PDB Compounds: (A:) Arginine deiminase

SCOPe Domain Sequences for d1s9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9ra_ d.126.1.4 (A:) Arginine deiminase {Mycoplasma arginini [TaxId: 2094]}
svfdskfkgihvyseigelesvlvhepgreidyitparldellfsaileshdarkehkqf
vaelkandinvvelidlvaetydlasqeakdklieefledsepvlseehkvvvrnflkak
ktsrelveimmagitkydlgieadhelivdpmpnlyftrdpfasvgngvtihymrykvrq
retlfsrfvfsnhpklintpwyydpslklsieggdvfiynndtlvvgvsertdlqtvtll
aknivankecefkrivainvpkwtnlmhldtwltmldkdkflyspiandvfkfwdydlvn
ggaepqpvenglplegllqsiinkkpvlipiagegasqmeierethfdgtnylairpgvv
igysrnektnaaleaagikvlpfhgnqlslgmgnarcmsmplsrkdvkw

SCOPe Domain Coordinates for d1s9ra_:

Click to download the PDB-style file with coordinates for d1s9ra_.
(The format of our PDB-style files is described here.)

Timeline for d1s9ra_: