SCOPe 2.01: Domain d1s9ea1: 1s9e A:430-552

Lineage for d1s9ea1 (1s9e A:430-552)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1s9ea1: 1s9e A:430-552 [98752]
   Other proteins in same PDB: d1s9ea2, d1s9eb_
   complexed with adb

Details for d1s9ea1

PDB Entry: 1s9e, 2.6 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385

PDB Compounds: (A:) POL polyprotein [Contains:Reverse transcriptase]

SCOPe Domain Sequences for d1s9ea1:

Sequence; same for both SEQRES and ATOM records:

>d1s9ea1 c.55.3.1 (A:430-552) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d1s9ea1:

• d1s9ea1 first appeared in SCOP 1.67
  
• d1s9ea1 appears in SCOP 1.75
  
• d1s9ea1 appears in SCOPe 2.02
  
• d1s9ea1 appears in the current release, SCOPe 2.08