Lineage for d1s9de_ (1s9d E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010331Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2010332Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 2010348Protein Exchange factor ARNO [48427] (1 species)
  7. 2010349Species Human (Homo sapiens) [TaxId:9606] [48428] (6 PDB entries)
  8. 2010352Domain d1s9de_: 1s9d E: [98751]
    Other proteins in same PDB: d1s9da_
    complexed with afb, gdp, mg

Details for d1s9de_

PDB Entry: 1s9d (more details), 1.8 Å

PDB Description: arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
PDB Compounds: (E:) arno

SCOPe Domain Sequences for d1s9de_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9de_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]}
ktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylg
ereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcnp
gvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlyd
sirnepfkipedd

SCOPe Domain Coordinates for d1s9de_:

Click to download the PDB-style file with coordinates for d1s9de_.
(The format of our PDB-style files is described here.)

Timeline for d1s9de_: