Lineage for d1s9de_ (1s9d E:)
- Root: SCOP 1.69
Class a: All alpha proteins [46456] (218 folds) 
Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.3: Sec7 domain [48425] (1 family) 
Family a.118.3.1: Sec7 domain [48426] (4 proteins) Protein Exchange factor ARNO [48427] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48428] (5 PDB entries) 
Domain d1s9de_: 1s9d E: [98751]
Other proteins in same PDB: d1s9da_
Details for d1s9de_
PDB Entry: 1s9d (more details), 1.8 Å
PDB Description: arf1[delta 1-17]-gdp-mg in complex with brefeldin a and a sec7 domain
SCOP Domain Sequences for d1s9de_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9de_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens)}
ktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylg
ereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqryclcnp
gvfqstdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlyd
sirnepfkipedd
SCOP Domain Coordinates for d1s9de_:
Click to download the PDB-style file with coordinates for d1s9de_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s9de_:
- d1s9de_ first appeared in SCOP 1.67
- d1s9de_ appears in SCOP 1.71
- d1s9de_ appears in the current release, SCOPe 2.08
View in 3D
