Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (37 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (8 species) |
Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (7 PDB entries) |
Domain d1s9da_: 1s9d A: [98750] Other proteins in same PDB: d1s9de_ complexed with a sec7 domain complexed with afb, gdp, mg; mutant |
PDB Entry: 1s9d (more details), 1.8 Å
SCOP Domain Sequences for d1s9da_:
Sequence, based on SEQRES records: (download)
>d1s9da_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1} mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlr
>d1s9da_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1} mrilmvgldaagkttilyklktiptigfnvetveyknisftvwdvggqdkirplwrhyfq ntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaaeitdkl glhslrhrnwyiqatcatsgdglyegldwlsnqlr
Timeline for d1s9da_: