Lineage for d1s97c1 (1s97 C:241-341)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616690Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 616691Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 616692Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 616693Protein DinB homolog (DBH) [100881] (2 species)
  7. 616698Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (11 PDB entries)
  8. 616710Domain d1s97c1: 1s97 C:241-341 [98746]
    Other proteins in same PDB: d1s97a2, d1s97b2, d1s97c2, d1s97d2

Details for d1s97c1

PDB Entry: 1s97 (more details), 2.4 Å

PDB Description: DPO4 with GT mismatch

SCOP Domain Sequences for d1s97c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s97c1 d.240.1.1 (C:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d1s97c1:

Click to download the PDB-style file with coordinates for d1s97c1.
(The format of our PDB-style files is described here.)

Timeline for d1s97c1: