Lineage for d1s97b1 (1s97 B:241-341)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008408Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 3008409Protein DinB homolog (DBH) [100881] (3 species)
  7. 3008418Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)
  8. 3008435Domain d1s97b1: 1s97 B:241-341 [98744]
    Other proteins in same PDB: d1s97a2, d1s97b2, d1s97c2, d1s97d2
    protein/DNA complex; complexed with ca, dct

Details for d1s97b1

PDB Entry: 1s97 (more details), 2.4 Å

PDB Description: DPO4 with GT mismatch
PDB Compounds: (B:) DNA polymerase IV

SCOPe Domain Sequences for d1s97b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s97b1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOPe Domain Coordinates for d1s97b1:

Click to download the PDB-style file with coordinates for d1s97b1.
(The format of our PDB-style files is described here.)

Timeline for d1s97b1: