SCOPe 2.06: Domain d1s96b_: 1s96 B:

Lineage for d1s96b_ (1s96 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (5 species)

7. Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)

8. Domain d1s96b_: 1s96 B: [98741]
   complexed with po4, unx

Details for d1s96b_

PDB Entry: 1s96, 2 Å

PDB Description: The 2.0 A X-ray structure of Guanylate Kinase from E.coli

PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d1s96b_:

Sequence; same for both SEQRES and ATOM records:

>d1s96b_ c.37.1.1 (B:) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdalisklla

Timeline for d1s96b_:

• d1s96b_ first appeared in SCOP 1.67
  
• d1s96b_ appears in SCOPe 2.05
  
• d1s96b_ appears in SCOPe 2.07
  
• d1s96b_ appears in the current release, SCOPe 2.08