Lineage for d1s96a_ (1s96 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581394Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 581529Protein Guanylate kinase [52542] (4 species)
  7. 581535Species Escherichia coli [TaxId:562] [102338] (1 PDB entry)
  8. 581536Domain d1s96a_: 1s96 A: [98740]

Details for d1s96a_

PDB Entry: 1s96 (more details), 2 Å

PDB Description: The 2.0 A X-ray structure of Guanylate Kinase from E.coli

SCOP Domain Sequences for d1s96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdaliskllad

SCOP Domain Coordinates for d1s96a_:

Click to download the PDB-style file with coordinates for d1s96a_.
(The format of our PDB-style files is described here.)

Timeline for d1s96a_: